PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00016.1_g00047.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 1127aa    MW: 126454 Da    PI: 5.8663
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00016.1_g00047.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.18.4e-18260306148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg WT+eEde+l +av+ + g++Wk+Ia+ +   Rt+ qc +rwqk+l
  Rsa1.0_00016.1_g00047.1 260 RGQWTAEEDEILTKAVHSFKGKNWKKIAEFFK-DRTDVQCLHRWQKVL 306
                              89*****************************9.************986 PP

2Myb_DNA-binding62.58.4e-20312358148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              +g+WT+eEde +v++++++G++ W+tIar ++ gR +kqc++rw+++l
  Rsa1.0_00016.1_g00047.1 312 KGPWTKEEDEMIVQLIQKYGPKKWSTIARFLP-GRIGKQCRERWHNHL 358
                              79******************************.*************97 PP

3Myb_DNA-binding42.81.2e-13364406145
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                              + +WT+eE++ l++a++ +G++ W+   + ++ gR+++ +k++w+
  Rsa1.0_00016.1_g00047.1 364 KEAWTQEEELVLIRAHQIYGNR-WAELTKFLP-GRSDNGIKNHWH 406
                              579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056708.1E-231299IPR008532Domain of unknown function DUF814
PROSITE profilePS5129417.673255306IPR017930Myb domain
SMARTSM007174.6E-15259308IPR001005SANT/Myb domain
PfamPF002492.0E-15260306IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-22261314IPR009057Homeodomain-like
SuperFamilySSF466893.18E-15261316IPR009057Homeodomain-like
CDDcd001673.52E-13263306No hitNo description
PROSITE profilePS5129432.297307362IPR017930Myb domain
SuperFamilySSF466891.4E-31309405IPR009057Homeodomain-like
SMARTSM007175.1E-19311360IPR001005SANT/Myb domain
PfamPF002491.3E-17312358IPR001005SANT/Myb domain
CDDcd001671.85E-16314358No hitNo description
Gene3DG3DSA:1.10.10.602.6E-27315362IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.4E-19363413IPR009057Homeodomain-like
SMARTSM007172.4E-12363411IPR001005SANT/Myb domain
PROSITE profilePS5129418.425363413IPR017930Myb domain
PfamPF002498.9E-12364407IPR001005SANT/Myb domain
CDDcd001671.75E-9366406No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1127 aa     Download sequence    Send to blast
MVFYFKARPD AGDYTIFMGL DKFENEELIK YGFPEDVWFH VDKMSSAHVY LRLHKGQGFD  60
DISEGVLEDC AQLVKANSIQ GNKVNNVDVV YTPWSNLKKT ASMDVGQVGF HNSKMVRTIR  120
VEKRVNEIIN RLNKTKVERT PDLRAEREAV NAAERAERKQ HLREKKKRED IERLEKERQA  180
DMRSYKGLMV TDKMTSNKDI ASSNKSIQEL EDDFMVYLLM ESECTTTTSS TPPPPQGITH  240
EGNPKSRQGR TSGPARRSTR GQWTAEEDEI LTKAVHSFKG KNWKKIAEFF KDRTDVQCLH  300
RWQKVLNPEL VKGPWTKEED EMIVQLIQKY GPKKWSTIAR FLPGRIGKQC RERWHNHLNP  360
AINKEAWTQE EELVLIRAHQ IYGNRWAELT KFLPGRSDNG IKNHWHSAVK KKLDSYMSSG  420
LLDQYQAMPL APYDRSSALQ SAFMQSAMDG SGCVSGQAEL EIENCQISSM AGCSMSAKDY  480
QNGIMNVNEG AAYRSDQYYY PELEDISVSI SEGSYEMEDC SQFSVSASTS QDYQFDFQEL  540
SDISLEMSHD MSELPIPYTK ERKESSLGAP NSISSIDVAT YTNRADVQTP ETECCRVLFL  600
DQESEGLSVS RSSTQEPNKE DYQDPVMCAS SASEVTKSPM KSSSSTSIAT PASGKETLRP  660
APLIITPEKY SKKTSGLMCH PFEAEPNCRT NENGSFICIN DPSSSTCVGE RPNNTSEEDE  720
SYHLNDSKKL VPVNDFASLA EVKPHSLPKH ETNMSSEQHH EDVGASSSSL CFPSLDLPAF  780
NDPLHDYSPL GIRKLLMSSM ACISPLRLWE SPTGKKTLAG AKSILRKRTR DLLTPLSEKR  840
SDKKLETDIA ASLAKDFSRL DVMFDESESR ESISGTSAGV NLGDKENQES LRGEHTSLVS  900
HRMPEETMDV SKSLVKQQQQ TCLEANVQRA ESFSGVLSES NTNKQVLSPP GQSETKAVKA  960
QVSTPRNHLQ RSLMATSNKE QHSSASLCLV VSSPSRARNT EGHLANNETN NENFSIFCGT  1020
PFRRGLESPS AWKSPFYVNS LLPSPRFDTD ITIEDMGYIF SPGESIGMLT QRHEHTSGFA  1080
AFNAMDISLS PSTDDARKMK DFNKENNDPL MAEGRVLDFN DCESPTK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C6e-672604136159MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-672604136159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1157167RKQHLREKKKR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY1426500.0AY142650.1 Arabidopsis thaliana unknown protein (At5g11500) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009121938.10.0PREDICTED: myb-related protein 3R-1-like
RefseqXP_009121937.10.0PREDICTED: myb-related protein 3R-1-like
TrEMBLA0A078BYB40.0A0A078BYB4_BRANA; BnaA10g20990D protein
STRINGBra008956.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132131828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.10.0myb domain protein 3r-4